MORN4 anticorps (Middle Region)

N° du produit ABIN631870

Détail du produit anti-MORN4 anticorps

Antigène: MORN4 (MORN Repeat Containing 4 (MORN4))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MORN4 est non-conjugé

Application: Western Blotting (WB)

Specificité: C10 ORF83 antibody was raised against the middle region of C10 rf83

Purification: Affinity purified

Immunogène: C10 ORF83 antibody was raised using the middle region of C10 rf83 corresponding to a region with amino acids FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C10ORF83 Blocking Peptide, catalog no. 33R-2907, is also available for use as a blocking control in assays to test for specificity of this C10ORF83 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF83 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MORN4

Antigène: MORN4 (MORN Repeat Containing 4 (MORN4))

Autre désignation: C10ORF83 (MORN4 Produits)

Synonymes: anticorps zgc:113281, anticorps DKFZp459E156, anticorps C10orf83, anticorps bA548K23.4, anticorps C10ORF83, anticorps C26H10orf83, anticorps RGD1307336, anticorps MORN repeat containing 4, anticorps MORN4, anticorps morn4, anticorps Morn4

Sujet: The function of C10orf83 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 16 kDa (MW of target protein)