OSCP1 anticorps (N-Term)

N° du produit ABIN631871

Détail du produit anti-OSCP1 anticorps

Antigène: OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OSCP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF102 antibody was raised against the N terminal Of C1 rf102

Purification: Affinity purified

Immunogène: C1 ORF102 antibody was raised using the N terminal Of C1 rf102 corresponding to a region with amino acids MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF102 Blocking Peptide, catalog no. 33R-6525, is also available for use as a blocking control in assays to test for specificity of this C1ORF102 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF102 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OSCP1

Antigène: OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))

Autre désignation: C1ORF102 (OSCP1 Produits)

Synonymes: anticorps nor1, anticorps oscp1, anticorps zgc:171454, anticorps 1810007P19Rik, anticorps 5730415O04, anticorps 6030436A01Rik, anticorps RGD1306596, anticorps C1orf102, anticorps NOR1, anticorps organic solute carrier partner 1, anticorps organic solute carrier partner 1 L homeolog, anticorps organic solute carrier partner 1a, anticorps OSCP1, anticorps oscp1, anticorps oscp1.L, anticorps oscp1a, anticorps Oscp1

Sujet: C1ORF102 may be involved in drug clearance in the placenta.

Poids moléculaire: 43 kDa (MW of target protein)