CCDC54 anticorps (N-Term)
-
- Antigène Voir toutes CCDC54 Anticorps
- CCDC54 (Coiled-Coil Domain Containing 54 (CCDC54))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CCDC54 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CCDC54 antibody was raised against the N terminal of CCDC54
- Purification
- Affinity purified
- Immunogène
- CCDC54 antibody was raised using the N terminal of CCDC54 corresponding to a region with amino acids MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH
- Top Product
- Discover our top product CCDC54 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CCDC54 Blocking Peptide, catalog no. 33R-6277, is also available for use as a blocking control in assays to test for specificity of this CCDC54 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC54 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CCDC54 (Coiled-Coil Domain Containing 54 (CCDC54))
- Autre désignation
- CCDC54 (CCDC54 Produits)
- Synonymes
- anticorps CCDC54, anticorps NYD-SP17, anticorps SP17, anticorps 1700007N18Rik, anticorps AI644412, anticorps BB013989, anticorps RGD1559779, anticorps coiled-coil domain containing 54, anticorps CCDC54, anticorps Ccdc54
- Sujet
- The specific function of CCDC54 is not yet known.
- Poids moléculaire
- 36 kDa (MW of target protein)
-