Nop10 anticorps (Middle Region)
-
- Antigène Voir toutes Nop10 Anticorps
- Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Nop10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NOLA3 antibody was raised against the middle region of Nola3
- Purification
- Affinity purified
- Immunogène
- NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK
- Top Product
- Discover our top product Nop10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NOLA3 Blocking Peptide, catalog no. 33R-5997, is also available for use as a blocking control in assays to test for specificity of this NOLA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))
- Autre désignation
- NOLA3 (Nop10 Produits)
- Synonymes
- anticorps DKCB1, anticorps NOLA3, anticorps NOP10P, anticorps 1110036B12Rik, anticorps Nola3, anticorps nola3, anticorps zgc:109956, anticorps NOP10 ribonucleoprotein, anticorps NOP10 ribonucleoprotein homolog (yeast), anticorps NOP10, anticorps Nop10, anticorps nop10
- Sujet
- This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.
- Poids moléculaire
- 8 kDa (MW of target protein)
-