RPESP anticorps (C-Term)

N° du produit ABIN631879

Détail du produit anti-RPESP anticorps

Antigène: RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))

Épitope: C-Term

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPESP est non-conjugé

Application: Western Blotting (WB)

Specificité: RPESP antibody was raised against the C terminal of RPESP

Purification: Affinity purified

Immunogène: RPESP antibody was raised using the C terminal of RPESP corresponding to a region with amino acids WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC

Information d'application

Indications d'application: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPESP Blocking Peptide, catalog no. 33R-9981, is also available for use as a blocking control in assays to test for specificity of this RPESP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPESP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPESP

Antigène: RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))

Autre désignation: RPESP (C8orf84 Produits)

Synonymes: anticorps C8orf84, anticorps RPESP, anticorps C14H8orf84, anticorps Gm106, anticorps Rpesp, anticorps RGD1559717, anticorps RPE-spondin, anticorps somatomedin B and thrombospondin type 1 domain containing, anticorps somatomedin B and thrombospondin, type 1 domain containing, anticorps Tsp_04711, anticorps SBSPON, anticorps Sbspon

Sujet: RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.

Poids moléculaire: 29 kDa (MW of target protein)