DNALI1 anticorps (N-Term)

N° du produit ABIN631888

Détail du produit anti-DNALI1 anticorps

Antigène: DNALI1 (Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNALI1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DNALI1 antibody was raised against the N terminal of DNALI1

Purification: Affinity purified

Immunogène: DNALI1 antibody was raised using the N terminal of DNALI1 corresponding to a region with amino acids MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNALI1 Blocking Peptide, catalog no. 33R-6612, is also available for use as a blocking control in assays to test for specificity of this DNALI1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNALI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNALI1

Antigène: DNALI1 (Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1))

Autre désignation: DNALI1 (DNALI1 Produits)

Synonymes: anticorps zgc:171493, anticorps zgc:171595, anticorps P28, anticorps dJ423B22.5, anticorps hp28, anticorps 1700023A09Rik, anticorps AW049135, anticorps dynein axonemal light intermediate chain 1, anticorps dynein, axonemal, light intermediate chain 1, anticorps dynein axonemal light intermediate chain 1 S homeolog, anticorps dynein, axonemal, light intermediate polypeptide 1, anticorps DNALI1, anticorps dnali1, anticorps dnali1.S, anticorps Dnali1

Sujet: DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.

Poids moléculaire: 31 kDa (MW of target protein)