C19orf47 anticorps (C-Term)

N° du produit ABIN631889

Détail du produit anti-C19orf47 anticorps

Antigène: C19orf47 (Chromosome 19 Open Reading Frame 47 (C19orf47))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C19orf47 est non-conjugé

Application: Western Blotting (WB)

Specificité: C19 ORF47 antibody was raised against the C terminal Of C19 rf47

Purification: Affinity purified

Immunogène: C19 ORF47 antibody was raised using the C terminal Of C19 rf47 corresponding to a region with amino acids DSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMDHAGTVSVFKR

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19ORF47 Blocking Peptide, catalog no. 33R-2176, is also available for use as a blocking control in assays to test for specificity of this C19ORF47 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C19orf47

Antigène: C19orf47 (Chromosome 19 Open Reading Frame 47 (C19orf47))

Autre désignation: C19ORF47 (C19orf47 Produits)

Synonymes: anticorps MGC79696, anticorps chromosome 19 open reading frame 47, anticorps chromosome 19 open reading frame 47 L homeolog, anticorps RIKEN cDNA 2310022A10 gene, anticorps similar to CG16812-PA, anticorps chromosome 18 open reading frame, human C19orf47, anticorps C19orf47, anticorps c19orf47.L, anticorps c19orf47, anticorps 2310022A10Rik, anticorps RGD1307554, anticorps C18H19orf47

Sujet: The function of Chromosome 19 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 38 kDa (MW of target protein)