DPH2 anticorps
-
- Antigène Voir toutes DPH2 Anticorps
- DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DPH2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVA
- Top Product
- Discover our top product DPH2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DPH2 Blocking Peptide, catalog no. 33R-9317, is also available for use as a blocking control in assays to test for specificity of this DPH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))
- Autre désignation
- DPH2 (DPH2 Produits)
- Synonymes
- anticorps DPH2L2, anticorps 9130020C19Rik, anticorps AI467389, anticorps Dph2l2, anticorps id:ibd5058, anticorps zgc:162269, anticorps DPH2 homolog, anticorps DPH2 homolog (S. cerevisiae), anticorps hypothetical protein, anticorps DPH2, anticorps Dph2, anticorps dph2, anticorps CAALFM_C400690CA
- Sujet
- DPH2 gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 52 kDa (MW of target protein)
-