ODF3L1 anticorps (N-Term)

N° du produit ABIN631891

Détail du produit anti-ODF3L1 anticorps

Antigène: ODF3L1 (Outer Dense Fiber of Sperm Tails 3-Like 1 (ODF3L1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ODF3L1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ODF3 L1 antibody was raised against the N terminal of ODF3 1

Purification: Affinity purified

Immunogène: ODF3 L1 antibody was raised using the N terminal of ODF3 1 corresponding to a region with amino acids KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ODF3L1 Blocking Peptide, catalog no. 33R-4527, is also available for use as a blocking control in assays to test for specificity of this ODF3L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ODF3L1

Antigène: ODF3L1 (Outer Dense Fiber of Sperm Tails 3-Like 1 (ODF3L1))

Autre désignation: ODF3L1 (ODF3L1 Produits)

Synonymes: anticorps BC049697, anticorps Gm1116, anticorps outer dense fiber of sperm tails 3 like 1, anticorps outer dense fiber of sperm tails 3-like 1, anticorps ODF3L1, anticorps Odf3l1

Sujet: The function of ODF3L1 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 31 kDa (MW of target protein)