PAD4 anticorps (Middle Region)
-
- Antigène Voir toutes PAD4 (PADI4) Anticorps
- PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PAD4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PADI4 antibody was raised against the middle region of PADI4
- Purification
- Affinity purified
- Immunogène
- PADI4 antibody was raised using the middle region of PADI4 corresponding to a region with amino acids TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL
- Top Product
- Discover our top product PADI4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PADI4 Blocking Peptide, catalog no. 33R-9085, is also available for use as a blocking control in assays to test for specificity of this PADI4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PADI4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))
- Autre désignation
- PADI4 (PADI4 Produits)
- Synonymes
- anticorps PAD, anticorps PAD4, anticorps PADI5, anticorps PDI4, anticorps PDI5, anticorps Pad4, anticorps Pdi4, anticorps peptidyl arginine deiminase 4, anticorps peptidyl arginine deiminase, type IV, anticorps PADI4, anticorps Padi4
- Sujet
- PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.
- Poids moléculaire
- 74 kDa (MW of target protein)
-