ARHGAP28 anticorps (C-Term)

N° du produit ABIN631901

Détail du produit anti-ARHGAP28 anticorps

Antigène: ARHGAP28 (rho GTPase Activating Protein 28 (ARHGAP28))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARHGAP28 est non-conjugé

Application: Western Blotting (WB)

Specificité: ARHGAP28 antibody was raised against the C terminal of ARHGAP28

Purification: Affinity purified

Immunogène: ARHGAP28 antibody was raised using the C terminal of ARHGAP28 corresponding to a region with amino acids AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPKHVFLFTIGLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARHGAP28 Blocking Peptide, catalog no. 33R-1293, is also available for use as a blocking control in assays to test for specificity of this ARHGAP28 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARHGAP28

Antigène: ARHGAP28 (rho GTPase Activating Protein 28 (ARHGAP28))

Autre désignation: ARHGAP28 (ARHGAP28 Produits)

Synonymes: anticorps RGD1559882, anticorps ARHGAP28, anticorps AU044757, anticorps AW550892, anticorps E130310N06, anticorps Rho GTPase activating protein 28, anticorps Arhgap28, anticorps ARHGAP28

Sujet: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Poids moléculaire: 62 kDa (MW of target protein)