EARS2 anticorps
-
- Antigène Voir toutes EARS2 Anticorps
- EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EARS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- EARS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL
- Top Product
- Discover our top product EARS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EARS2 Blocking Peptide, catalog no. 33R-8975, is also available for use as a blocking control in assays to test for specificity of this EARS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EARS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))
- Autre désignation
- EARS2 (EARS2 Produits)
- Synonymes
- anticorps mse1, anticorps 3230401I01Rik, anticorps AL024049, anticorps mKIAA1970, anticorps COXPD12, anticorps MSE1, anticorps RGD1307904, anticorps ears2, anticorps glutamyl-tRNA synthetase 2, mitochondrial, anticorps zgc:153247, anticorps EARS2, anticorps ears2, anticorps Ears2, anticorps zgc:153247
- Sujet
- EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.
- Poids moléculaire
- 59 kDa (MW of target protein)
-