MAGEA3 anticorps (Middle Region)

N° du produit ABIN631907

Détail du produit anti-MAGEA3 anticorps

Antigène: MAGEA3 (Melanoma Antigen Family A, 3 (MAGEA3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGEA3 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAGEA3 antibody was raised against the middle region of MAGEA3

Purification: Affinity purified

Immunogène: MAGEA3 antibody was raised using the middle region of MAGEA3 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAGEA3 Blocking Peptide, catalog no. 33R-1420, is also available for use as a blocking control in assays to test for specificity of this MAGEA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGEA3

Antigène: MAGEA3 (Melanoma Antigen Family A, 3 (MAGEA3))

Autre désignation: MAGEA3 (MAGEA3 Produits)

Synonymes: anticorps CT1.3, anticorps HIP8, anticorps HYPD, anticorps MAGE3, anticorps MAGEA6, anticorps Mage-a3, anticorps MAGEA3, anticorps MAGE family member A3, anticorps melanoma antigen, family A, 3, anticorps melanoma antigen family A, 3, anticorps MAGEA3, anticorps Magea3

Sujet: MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Poids moléculaire: 35 kDa (MW of target protein)