VPS37C anticorps

N° du produit ABIN631911

Détail du produit anti-VPS37C anticorps

Antigène: VPS37C (Vacuolar Protein Sorting 37C (VPS37C))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPS37C est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: VPS37 C antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPS37C Blocking Peptide, catalog no. 33R-5323, is also available for use as a blocking control in assays to test for specificity of this VPS37C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPS37C

Antigène: VPS37C (Vacuolar Protein Sorting 37C (VPS37C))

Autre désignation: VPS37C (VPS37C Produits)

Synonymes: anticorps RGD1309258, anticorps 5730409F24Rik, anticorps AU042646, anticorps VPS37C, ESCRT-I subunit, anticorps vacuolar protein sorting 37C, anticorps VPS37C, anticorps Vps37c

Sujet: VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies.

Poids moléculaire: 39 kDa (MW of target protein)