DOK5 anticorps (N-Term)

N° du produit ABIN631914

Détail du produit anti-DOK5 anticorps

Antigène: DOK5 (Docking Protein 5 (DOK5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DOK5 est non-conjugé

Application: Western Blotting (WB)

Specificité: DOK5 antibody was raised against the N terminal of DOK5

Purification: Affinity purified

Immunogène: DOK5 antibody was raised using the N terminal of DOK5 corresponding to a region with amino acids GPKRLEKFSDERAAYFRCYHKVTELNNVKNVARLPKSTKKHAIGIYFNDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DOK5 Blocking Peptide, catalog no. 33R-3474, is also available for use as a blocking control in assays to test for specificity of this DOK5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DOK5

Antigène: DOK5 (Docking Protein 5 (DOK5))

Autre désignation: DOK5 (DOK5 Produits)

Synonymes: anticorps C20orf180, anticorps 2700055C10Rik, anticorps RGD1562846, anticorps docking protein 5, anticorps Docking protein 5, anticorps DOK5, anticorps dok5, anticorps Dok5

Sujet: DOK5 is a member of the DOK family of membrane proteins, which are adapter proteins involved in signal transduction. It interacts with phosphorylated receptor tyrosine kinases to mediate neurite outgrowth and activation of the MAP kinase pathway. In contrast to other DOK family proteins, this protein does not interact with RASGAP.

Poids moléculaire: 34 kDa (MW of target protein)