MVK anticorps (N-Term)

N° du produit ABIN631917

Détail du produit anti-MVK anticorps

Antigène: MVK (Mevalonate Kinase (MVK))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MVK est non-conjugé

Application: Western Blotting (WB)

Specificité: MVK antibody was raised against the N terminal of MVK

Purification: Affinity purified

Immunogène: MVK antibody was raised using the N terminal of MVK corresponding to a region with amino acids LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MVK Blocking Peptide, catalog no. 33R-4807, is also available for use as a blocking control in assays to test for specificity of this MVK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MVK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MVK

Antigène: MVK (Mevalonate Kinase (MVK))

Autre désignation: MVK (MVK Produits)

Synonymes: anticorps F21A20.160, anticorps F21A20_160, anticorps MEVALONATE KINASE, anticorps MVK, anticorps mevalonate kinase, anticorps DDBDRAFT_0168621, anticorps DDBDRAFT_0302479, anticorps DDB_0168621, anticorps DDB_0302479, anticorps LRBP, anticorps MK, anticorps MVLK, anticorps POROK3, anticorps 2310010A05Rik, anticorps AI256848, anticorps AI414037, anticorps zgc:103473, anticorps mevalonate kinase, anticorps mvk, anticorps hypothetical protein, anticorps MVK, anticorps MK, anticorps MA_RS03165, anticorps PAB_RS02890, anticorps LMOf2365_0011, anticorps mvk, anticorps RCI_RS14145, anticorps TGAM_RS08735, anticorps MMAH_RS07705, anticorps TAGG_RS01605, anticorps SHELL_RS02965, anticorps MVOL_RS03085, anticorps Igag_1464, anticorps VDIS_RS11260, anticorps MFER_RS04560, anticorps DESMU_RS01555, anticorps ARCVE_RS02955, anticorps MZHIL_RS05110, anticorps Mvk

Sujet: MVK is the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash.

Poids moléculaire: 42 kDa (MW of target protein)