MVK anticorps (N-Term)

N° du produit ABIN631917

Détail du produit anti-MVK anticorps

Antigène: MVK (Mevalonate Kinase (MVK))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MVK est non-conjugé

Application: Western Blotting (WB)

Specificité: MVK antibody was raised against the N terminal of MVK

Purification: Affinity purified

Immunogène: MVK antibody was raised using the N terminal of MVK corresponding to a region with amino acids LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MVK Blocking Peptide, catalog no. 33R-4807, is also available for use as a blocking control in assays to test for specificity of this MVK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MVK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MVK

Antigène: MVK (Mevalonate Kinase (MVK))

Autre désignation: MVK (MVK Produits)

Sujet: MVK is the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash.

Poids moléculaire: 42 kDa (MW of target protein)