CAPZA3 anticorps

N° du produit ABIN631921

Détail du produit anti-CAPZA3 anticorps

Antigène: CAPZA3 (Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CAPZA3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CAPZA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CAPZA3 Blocking Peptide, catalog no. 33R-6555, is also available for use as a blocking control in assays to test for specificity of this CAPZA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPZA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CAPZA3

Antigène: CAPZA3 (Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3))

Autre désignation: CAPZA3 (CAPZA3 Produits)

Synonymes: anticorps CAPZA3, anticorps CAPPA3, anticorps Gsg3, anticorps 510-4, anticorps Cappa3, anticorps Tex8, anticorps repro32, anticorps capping actin protein of muscle Z-line alpha subunit 3, anticorps capping protein (actin filament) muscle Z-line, alpha 3, anticorps CAPZA3, anticorps Capza3

Sujet: F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. CAPZA3 may play a role in the morphogenesis of spermatid.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization