C16orf78 anticorps (Middle Region)

N° du produit ABIN631923

Détail du produit anti-C16orf78 anticorps

Antigène: C16orf78 (Chromosome 16 Open Reading Frame 78 (C16orf78))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C16orf78 est non-conjugé

Application: Western Blotting (WB)

Specificité: C16 ORF78 antibody was raised against the middle region of C16 rf78

Purification: Affinity purified

Immunogène: C16 ORF78 antibody was raised using the middle region of C16 rf78 corresponding to a region with amino acids GVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C16ORF78 Blocking Peptide, catalog no. 33R-3634, is also available for use as a blocking control in assays to test for specificity of this C16ORF78 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF78 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C16orf78

Antigène: C16orf78 (Chromosome 16 Open Reading Frame 78 (C16orf78))

Autre désignation: C16ORF78 (C16orf78 Produits)

Synonymes: anticorps chromosome 16 open reading frame 78, anticorps C16orf78

Sujet: The function of C16orf78 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 34 kDa (MW of target protein)