NRARP anticorps (Middle Region)

N° du produit ABIN631926

Détail du produit anti-NRARP anticorps

Antigène: NRARP (NOTCH-Regulated Ankyrin Repeat Protein (NRARP))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NRARP est non-conjugé

Application: Western Blotting (WB)

Specificité: NRARP antibody was raised against the middle region of NRARP

Purification: Affinity purified

Immunogène: NRARP antibody was raised using the middle region of NRARP corresponding to a region with amino acids QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NRARP Blocking Peptide, catalog no. 33R-7666, is also available for use as a blocking control in assays to test for specificity of this NRARP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRARP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NRARP

Antigène: NRARP (NOTCH-Regulated Ankyrin Repeat Protein (NRARP))

Autre désignation: NRARP (NRARP Produits)

Synonymes: anticorps 2700054M22Rik, anticorps Nrarp-a, anticorps fc89b12, anticorps id:ibd2282, anticorps wu:fa14d10, anticorps wu:fc89b12, anticorps zgc:100826, anticorps Nrarp-b, anticorps zgc:101875, anticorps Notch-regulated ankyrin repeat protein, anticorps NOTCH regulated ankyrin repeat protein, anticorps NOTCH regulated ankyrin repeat protein S homeolog, anticorps NOTCH-regulated ankyrin repeat protein, anticorps NOTCH regulated ankyrin repeat protein a, anticorps NOTCH regulated ankyrin repeat protein b, anticorps Nrarp, anticorps NRARP, anticorps nrarp.S, anticorps nrarpa, anticorps nrarpb

Sujet: NRARP may play a role in the formation of somites.

Poids moléculaire: 12 kDa (MW of target protein)