TTC12 anticorps (C-Term)

N° du produit ABIN631929

Détail du produit anti-TTC12 anticorps

Antigène: TTC12 (Tetratricopeptide Repeat Domain 12 (TTC12))

Épitope: C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TTC12 est non-conjugé

Application: Western Blotting (WB)

Specificité: TTC12 antibody was raised against the C terminal of TTC12

Purification: Affinity purified

Immunogène: TTC12 antibody was raised using the C terminal of TTC12 corresponding to a region with amino acids MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TTC12 Blocking Peptide, catalog no. 33R-6251, is also available for use as a blocking control in assays to test for specificity of this TTC12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TTC12

Antigène: TTC12 (Tetratricopeptide Repeat Domain 12 (TTC12))

Autre désignation: TTC12 (TTC12 Produits)

Synonymes: anticorps TPARM, anticorps E330017O07Rik, anticorps tetratricopeptide repeat domain 12, anticorps TTC12, anticorps Ttc12

Sujet: TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.

Poids moléculaire: 81 kDa (MW of target protein)