LRRC50 anticorps (N-Term)

N° du produit ABIN631930

Détail du produit anti-LRRC50 anticorps

Antigène: LRRC50 (Leucine Rich Repeat Containing 50 (LRRC50))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC50 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC50 antibody was raised against the N terminal of LRRC50

Purification: Affinity purified

Immunogène: LRRC50 antibody was raised using the N terminal of LRRC50 corresponding to a region with amino acids LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC50 Blocking Peptide, catalog no. 33R-5219, is also available for use as a blocking control in assays to test for specificity of this LRRC50 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC50

Antigène: LRRC50 (Leucine Rich Repeat Containing 50 (LRRC50))

Autre désignation: LRRC50 (LRRC50 Produits)

Synonymes: anticorps 4930457P18Rik, anticorps Lrrc50, anticorps LRRC50, anticorps CILD13, anticorps ODA7, anticorps LLRC50, anticorps RGD1310542, anticorps lrrc50, anticorps zgc:56169, anticorps dynein, axonemal assembly factor 1, anticorps dynein axonemal assembly factor 1, anticorps dynein, axonemal, assembly factor 1, anticorps Dnaaf1, anticorps DNAAF1, anticorps dnaaf1

Sujet: LRRC50 contains 6 LRR (leucine-rich) repeats. It is proposed that LRRC50 to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli.

Poids moléculaire: 80 kDa (MW of target protein)