FAM92B anticorps (N-Term)
-
- Antigène Tous les produits FAM92B
- FAM92B (Family with Sequence Similarity 92, Member B (FAM92B))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM92B est non-conjugé
- Application
- Western Blotting (WB)
- Specificité
- FAM92 B antibody was raised against the N terminal of FAM92
- Purification
- Affinity purified
- Immunogène
- FAM92 B antibody was raised using the N terminal of FAM92 corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM92B Blocking Peptide, catalog no. 33R-2839, is also available for use as a blocking control in assays to test for specificity of this FAM92B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM92B (Family with Sequence Similarity 92, Member B (FAM92B))
- Autre désignation
- FAM92B (FAM92B Produits)
- Synonymes
- anticorps 1700120B06Rik, anticorps RGD1560673, anticorps family with sequence similarity 92 member B, anticorps family with sequence similarity 92, member B, anticorps FAM92B, anticorps Fam92b
- Sujet
- The function of FAM92 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 35 kDa (MW of target protein)
-