FKBPL anticorps (N-Term)
-
- Antigène Voir toutes FKBPL Anticorps
- FKBPL (FK506 Binding Protein Like (FKBPL))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FKBPL est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FKBPL antibody was raised against the N terminal of FKBPL
- Purification
- Affinity purified
- Immunogène
- FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE
- Top Product
- Discover our top product FKBPL Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FKBPL Blocking Peptide, catalog no. 33R-5971, is also available for use as a blocking control in assays to test for specificity of this FKBPL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBPL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FKBPL (FK506 Binding Protein Like (FKBPL))
- Autre désignation
- FKBPL (FKBPL Produits)
- Synonymes
- anticorps FKBPL, anticorps ng7, anticorps dir1, anticorps wisp39, anticorps DIR1, anticorps NG7, anticorps WISP39, anticorps Ppiase-X, anticorps Wisp39, anticorps FK506 binding protein like, anticorps FK506 binding protein-like, anticorps FKBPL, anticorps fkbpl, anticorps Fkbpl
- Sujet
- The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking.
- Poids moléculaire
- 38 kDa (MW of target protein)
-