GSG1 anticorps (N-Term)

N° du produit ABIN631943

Détail du produit anti-GSG1 anticorps

Antigène: GSG1 (Germ Cell Associated 1 (GSG1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GSG1 antibody was raised against the N terminal of GSG1

Purification: Affinity purified

Immunogène: GSG1 antibody was raised using the N terminal of GSG1 corresponding to a region with amino acids NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSG1 Blocking Peptide, catalog no. 33R-6947, is also available for use as a blocking control in assays to test for specificity of this GSG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSG1

Antigène: GSG1 (Germ Cell Associated 1 (GSG1))

Autre désignation: GSG1 (GSG1 Produits)

Synonymes: anticorps germ cell associated 1, anticorps GSG1, anticorps Gsg1

Sujet: GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.

Poids moléculaire: 41 kDa (MW of target protein)