GSG1 anticorps (N-Term)
-
- Antigène Voir toutes GSG1 Anticorps
- GSG1 (Germ Cell Associated 1 (GSG1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GSG1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GSG1 antibody was raised against the N terminal of GSG1
- Purification
- Affinity purified
- Immunogène
- GSG1 antibody was raised using the N terminal of GSG1 corresponding to a region with amino acids NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD
- Top Product
- Discover our top product GSG1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GSG1 Blocking Peptide, catalog no. 33R-6947, is also available for use as a blocking control in assays to test for specificity of this GSG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GSG1 (Germ Cell Associated 1 (GSG1))
- Autre désignation
- GSG1 (GSG1 Produits)
- Synonymes
- anticorps germ cell associated 1, anticorps GSG1, anticorps Gsg1
- Sujet
- GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.
- Poids moléculaire
- 41 kDa (MW of target protein)
-