NMRAL1 anticorps (Middle Region)
-
- Antigène Voir toutes NMRAL1 Anticorps
- NMRAL1 (NmrA-Like Family Domain Containing 1 (NMRAL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NMRAL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NMRAL1 antibody was raised against the middle region of NMRAL1
- Purification
- Affinity purified
- Immunogène
- NMRAL1 antibody was raised using the middle region of NMRAL1 corresponding to a region with amino acids TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA
- Top Product
- Discover our top product NMRAL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NMRAL1 Blocking Peptide, catalog no. 33R-8999, is also available for use as a blocking control in assays to test for specificity of this NMRAL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMRAL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NMRAL1 (NmrA-Like Family Domain Containing 1 (NMRAL1))
- Autre désignation
- NMRAL1 (NMRAL1 Produits)
- Synonymes
- anticorps HSCARG, anticorps SDR48A1, anticorps 1110025F24Rik, anticorps AI256624, anticorps RGD1311451, anticorps NmrA like redox sensor 1, anticorps NmrA-like family domain containing 1, anticorps NMRAL1, anticorps Nmral1
- Sujet
- The function of this protein is binding, oxidoreductase activity and transcription repressor activity.
- Poids moléculaire
- 33 kDa (MW of target protein)
-