ANKRD2 anticorps
-
- Antigène Voir toutes ANKRD2 Anticorps
- ANKRD2 (Ankyrin Repeat Domain 2 (Stretch Responsive Muscle) (ANKRD2))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ANKRD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ANKRD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL
- Top Product
- Discover our top product ANKRD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ANKRD2 Blocking Peptide, catalog no. 33R-7516, is also available for use as a blocking control in assays to test for specificity of this ANKRD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ANKRD2 (Ankyrin Repeat Domain 2 (Stretch Responsive Muscle) (ANKRD2))
- Autre désignation
- ANKRD2 (ANKRD2 Produits)
- Synonymes
- anticorps ANKRD2, anticorps ankrd2-a, anticorps MGC52621, anticorps ankrd2-b, anticorps MGC83036, anticorps ARPP, anticorps Arpp, anticorps mArpp, anticorps AFT, anticorps AKR2A, anticorps F15J1.20, anticorps F15J1_20, anticorps ankyrin repeat-containing protein 2, anticorps ankyrin repeat domain 2, anticorps ankyrin repeat domain 2 (stretch responsive muscle), anticorps ankyrin repeat domain 2 (stretch responsive muscle) L homeolog, anticorps ankyrin repeat domain 2 (stretch responsive muscle) S homeolog, anticorps ankyrin repeat-containing protein 2, anticorps ANKRD2, anticorps ankrd2, anticorps ankrd2.L, anticorps ankrd2.S, anticorps Ankrd2, anticorps AKR2
- Sujet
- ANKRD2 may play an important role in skeletal muscle hypertrophy.
- Poids moléculaire
- 49 kDa (MW of target protein)
-