FBP2 anticorps (Middle Region)
-
- Antigène Voir toutes FBP2 Anticorps
- FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBP2 antibody was raised against the middle region of FBP2
- Purification
- Affinity purified
- Immunogène
- FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ
- Top Product
- Discover our top product FBP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBP2 Blocking Peptide, catalog no. 33R-10138, is also available for use as a blocking control in assays to test for specificity of this FBP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))
- Autre désignation
- FBP2 (FBP2 Produits)
- Synonymes
- anticorps 6330409F21Rik, anticorps Fbp2, anticorps Fubp2, anticorps Ksrp, anticorps Fbp-1, anticorps Fbp1, anticorps Rae-30, anticorps FBPase, anticorps zgc:101083, anticorps FBP2, anticorps MGC108013, anticorps FBP, anticorps fructose-bisphosphatase 2, anticorps KH-type splicing regulatory protein, anticorps fructose bisphosphatase 2, anticorps fructose-1,6-bisphosphatase 2, anticorps fructose-bisphosphatase 2 L homeolog, anticorps FBP2, anticorps Khsrp, anticorps Fbp2, anticorps fbp2, anticorps fbp2.L
- Sujet
- FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.
- Poids moléculaire
- 37 kDa (MW of target protein)
-