ADH5 anticorps
-
- Antigène Voir toutes ADH5 Anticorps
- ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADH5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ADH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVV
- Top Product
- Discover our top product ADH5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADH5 Blocking Peptide, catalog no. 33R-4667, is also available for use as a blocking control in assays to test for specificity of this ADH5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))
- Autre désignation
- ADH5 (ADH5 Produits)
- Synonymes
- anticorps ADH2, anticorps ADH-3, anticorps ADHX, anticorps FALDH, anticorps FDH, anticorps GSH-FDH, anticorps GSNOR, anticorps ADH1C, anticorps ADH3, anticorps wu:fb60b11, anticorps Adh-5, anticorps Adh3, anticorps adh-3, anticorps adh3, anticorps adh5, anticorps adhx, anticorps fdh, anticorps gsnor, anticorps ADH4, anticorps ADH5, anticorps alcohol dehydrogenase 1B (class I), beta polypeptide, anticorps alcohol dehydrogenase 5 (class III), chi polypeptide, anticorps alcohol dehydrogenase 5, anticorps alcohol dehydrogenase 5 (class III), chi polypeptide L homeolog, anticorps alcohol dehydrogenase class-3, anticorps ADH1B, anticorps ADH5, anticorps adh5, anticorps Adh5, anticorps adh5.L, anticorps LOC101112223
- Sujet
- This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.
- Poids moléculaire
- 40 kDa (MW of target protein)
-