POLR1E anticorps
-
- Antigène Voir toutes POLR1E Anticorps
- POLR1E (Polymerase (RNA) I Polypeptide E, 53kDa (POLR1E))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp POLR1E est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- POLR1 E antibody was raised using a synthetic peptide corresponding to a region with amino acids SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL
- Top Product
- Discover our top product POLR1E Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
POLR1E Blocking Peptide, catalog no. 33R-8675, is also available for use as a blocking control in assays to test for specificity of this POLR1E antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- POLR1E (Polymerase (RNA) I Polypeptide E, 53kDa (POLR1E))
- Autre désignation
- POLR1E (POLR1E Produits)
- Synonymes
- anticorps 53kDa, anticorps AU042259, anticorps D030019D19Rik, anticorps Paf53, anticorps Praf1, anticorps PAF53, anticorps PRAF1, anticorps RP11-405L18.3, anticorps RNA polymerase I subunit E, anticorps polymerase (RNA) I polypeptide E, anticorps polymerase (RNA) I polypeptide E L homeolog, anticorps POLR1E, anticorps polr1e, anticorps Polr1e, anticorps polr1e.L
- Sujet
- POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.
- Poids moléculaire
- 47 kDa (MW of target protein)
-