WDR1 anticorps (N-Term)

N° du produit ABIN631958

Détail du produit anti-WDR1 anticorps

Antigène: WDR1 (WD Repeat Domain 1 (WDR1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR1 antibody was raised against the N terminal of WDR1

Purification: Affinity purified

Immunogène: WDR1 antibody was raised using the N terminal of WDR1 corresponding to a region with amino acids DIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR1 Blocking Peptide, catalog no. 33R-1988, is also available for use as a blocking control in assays to test for specificity of this WDR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR1

Antigène: WDR1 (WD Repeat Domain 1 (WDR1))

Autre désignation: WDR1 (WDR1 Produits)

Synonymes: anticorps AIP1, anticorps NORI-1, anticorps Aip1, anticorps D5Wsu185e, anticorps rede, anticorps aip1, anticorps wdr1b, anticorps wu:fa66e09, anticorps zgc:55793, anticorps zgc:77547, anticorps wdr1, anticorps wdr1-a, anticorps wdr1-b, anticorps wdr1a, anticorps xAIP1-B, anticorps WD repeat domain 1, anticorps WD repeat domain 1 L homeolog, anticorps WD repeat domain 1 S homeolog, anticorps WDR1, anticorps Wdr1, anticorps wdr1.L, anticorps wdr1, anticorps wdr1.S

Sujet: WDR1 is a protein containing 9 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WD domains are involved in protein-protein interactions. WDR1 may help induce the disassembly of actin filaments.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Sensory Perception of Sound