WDR1 anticorps (N-Term)
-
- Antigène Voir toutes WDR1 Anticorps
- WDR1 (WD Repeat Domain 1 (WDR1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WDR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WDR1 antibody was raised against the N terminal of WDR1
- Purification
- Affinity purified
- Immunogène
- WDR1 antibody was raised using the N terminal of WDR1 corresponding to a region with amino acids DIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQ
- Top Product
- Discover our top product WDR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WDR1 Blocking Peptide, catalog no. 33R-1988, is also available for use as a blocking control in assays to test for specificity of this WDR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WDR1 (WD Repeat Domain 1 (WDR1))
- Autre désignation
- WDR1 (WDR1 Produits)
- Synonymes
- anticorps AIP1, anticorps NORI-1, anticorps Aip1, anticorps D5Wsu185e, anticorps rede, anticorps aip1, anticorps wdr1b, anticorps wu:fa66e09, anticorps zgc:55793, anticorps zgc:77547, anticorps wdr1, anticorps wdr1-a, anticorps wdr1-b, anticorps wdr1a, anticorps xAIP1-B, anticorps WD repeat domain 1, anticorps WD repeat domain 1 L homeolog, anticorps WD repeat domain 1 S homeolog, anticorps WDR1, anticorps Wdr1, anticorps wdr1.L, anticorps wdr1, anticorps wdr1.S
- Sujet
- WDR1 is a protein containing 9 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WD domains are involved in protein-protein interactions. WDR1 may help induce the disassembly of actin filaments.
- Poids moléculaire
- 66 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-