SOHLH1 anticorps (Middle Region)
-
- Antigène Voir toutes SOHLH1 Anticorps
- SOHLH1 (Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 1 (SOHLH1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SOHLH1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SOHLH1 antibody was raised against the middle region of SOHLH1
- Purification
- Affinity purified
- Immunogène
- SOHLH1 antibody was raised using the middle region of SOHLH1 corresponding to a region with amino acids EAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLT
- Top Product
- Discover our top product SOHLH1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SOHLH1 Blocking Peptide, catalog no. 33R-2251, is also available for use as a blocking control in assays to test for specificity of this SOHLH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOHLH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SOHLH1 (Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 1 (SOHLH1))
- Autre désignation
- SOHLH1 (SOHLH1 Produits)
- Synonymes
- anticorps C9orf157, anticorps NOHLH, anticorps SPATA27, anticorps TEB2, anticorps bA100C15.3, anticorps bHLHe80, anticorps Gm110, anticorps Nohlh, anticorps RGD1564440, anticorps spermatogenesis and oogenesis specific basic helix-loop-helix 1, anticorps SOHLH1, anticorps Sohlh1
- Sujet
- SOHLH1 contains 1 basic helix-loop-helix (bHLH) domain. It is a probable transcription factor required during spermatogenesis and oogenesis.
- Poids moléculaire
- 42 kDa (MW of target protein)
-