FSIP1 anticorps (Middle Region)

N° du produit ABIN631970

Détail du produit anti-FSIP1 anticorps

Antigène: FSIP1 (Fibrous Sheath Interacting Protein 1 (FSIP1))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FSIP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: FSIP1 antibody was raised against the middle region of FSIP1

Purification: Affinity purified

Immunogène: FSIP1 antibody was raised using the middle region of FSIP1 corresponding to a region with amino acids DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FSIP1 Blocking Peptide, catalog no. 33R-1906, is also available for use as a blocking control in assays to test for specificity of this FSIP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FSIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FSIP1

Antigène: FSIP1 (Fibrous Sheath Interacting Protein 1 (FSIP1))

Autre désignation: FSIP1 (FSIP1 Produits)

Synonymes: anticorps zgc:113106, anticorps 1700012M13Rik, anticorps 4933432K11Rik, anticorps fibrous sheath interacting protein 1, anticorps fibrous sheath-interacting protein 1, anticorps FSIP1, anticorps Fsip1, anticorps fsip1

Sujet: The function of FSIP1 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 66 kDa (MW of target protein)