RWDD4A anticorps (Middle Region)

N° du produit ABIN631971

Détail du produit anti-RWDD4A anticorps

Antigène: RWDD4A (RWDD4) (RWD Domain Containing 4 (RWDD4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RWDD4A est non-conjugé

Application: Western Blotting (WB)

Specificité: RWDD4 A antibody was raised against the middle region of RWDD4

Purification: Affinity purified

Immunogène: RWDD4 A antibody was raised using the middle region of RWDD4 corresponding to a region with amino acids SSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RWDD4A Blocking Peptide, catalog no. 33R-8816, is also available for use as a blocking control in assays to test for specificity of this RWDD4A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RWDD4A

Antigène: RWDD4A (RWDD4) (RWD Domain Containing 4 (RWDD4))

Autre désignation: RWDD4A (RWDD4 Produits)

Synonymes: anticorps BC016198, anticorps Gm1942, anticorps Rwdd4, anticorps FAM28A, anticorps RWDD4A, anticorps fam28a, anticorps rwdd4a, anticorps Rwdd4a, anticorps si:ch211-192e21.1, anticorps zgc:103545, anticorps RWD domain containing 4A, anticorps RWD domain containing 4, anticorps RWD domain containing 4 L homeolog, anticorps Rwdd4a, anticorps RWDD4, anticorps rwdd4.L, anticorps Rwdd4, anticorps rwdd

Sujet: The function of RWDD4 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 21 kDa (MW of target protein)