NOB1 anticorps
-
- Antigène Voir toutes NOB1 Anticorps
- NOB1 (RNA-Binding Protein NOB1 (NOB1))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NOB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE
- Top Product
- Discover our top product NOB1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NOB1 Blocking Peptide, catalog no. 33R-5294, is also available for use as a blocking control in assays to test for specificity of this NOB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NOB1 (RNA-Binding Protein NOB1 (NOB1))
- Autre désignation
- NOB1 (NOB1 Produits)
- Synonymes
- anticorps MEE6.26, anticorps MEE6_26, anticorps Nob1p, anticorps fc27e05, anticorps si:ch73-167i17.3, anticorps wu:fc27e05, anticorps ART-4, anticorps MST158, anticorps NOB1P, anticorps PSMD8BP1, anticorps 1700021I09Rik, anticorps Psmd8bp1, anticorps NIN1/PSMD8 binding protein 1 homolog, anticorps RNA-binding NOB1-like protein, anticorps RNA-binding protein nob1, anticorps RNA-binding protein NOB1, anticorps NIN1/RPN12 binding protein 1 homolog S homeolog, anticorps NIN1/RPN12 binding protein 1 homolog (S. cerevisiae), anticorps NIN1/RPN12 binding protein 1 homolog, anticorps NOB1, anticorps AT5G41190, anticorps EDI_130960, anticorps CpipJ_CPIJ012739, anticorps BDBG_01281, anticorps PAAG_04204, anticorps PITG_13300, anticorps nob1.S, anticorps nob1, anticorps Nob1
- Sujet
- NOB1 may play a role in mRNA degradation.
- Poids moléculaire
- 47 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-