PRR16 anticorps (Middle Region)
-
- Antigène Tous les produits PRR16
- PRR16 (Proline Rich 16 (PRR16))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRR16 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRR16 antibody was raised against the middle region of PRR16
- Purification
- Affinity purified
- Immunogène
- PRR16 antibody was raised using the middle region of PRR16 corresponding to a region with amino acids RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRR16 Blocking Peptide, catalog no. 33R-7888, is also available for use as a blocking control in assays to test for specificity of this PRR16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRR16 (Proline Rich 16 (PRR16))
- Autre désignation
- PRR16 (PRR16 Produits)
- Synonymes
- anticorps DSC54, anticorps 5430406M13Rik, anticorps AI607429, anticorps RGD1564528, anticorps proline rich 16, anticorps PRR16, anticorps prr16, anticorps Prr16
- Sujet
- The function of PRR16 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 30 kDa (MW of target protein)
-