LRRC49 anticorps (N-Term)
-
- Antigène Tous les produits LRRC49
- LRRC49 (Leucine Rich Repeat Containing 49 (LRRC49))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRRC49 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LRRC49 antibody was raised against the N terminal of LRRC49
- Purification
- Affinity purified
- Immunogène
- LRRC49 antibody was raised using the N terminal of LRRC49 corresponding to a region with amino acids KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRRC49 Blocking Peptide, catalog no. 33R-4703, is also available for use as a blocking control in assays to test for specificity of this LRRC49 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC49 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRRC49 (Leucine Rich Repeat Containing 49 (LRRC49))
- Autre désignation
- LRRC49 (LRRC49 Produits)
- Synonymes
- anticorps AI430817, anticorps AW050057, anticorps D430025H09Rik, anticorps PGs4, anticorps p79, anticorps RGD1309466, anticorps leucine rich repeat containing 49, anticorps LRRC49, anticorps lrrc49, anticorps Lrrc49
- Sujet
- The function of LRRC49 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 79 kDa (MW of target protein)
-