C11orf46 anticorps (N-Term)

N° du produit ABIN631992

Détail du produit anti-C11orf46 anticorps

Antigène: C11orf46 (Chromosome 11 Open Reading Frame 46 (C11orf46))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C11orf46 est non-conjugé

Application: Western Blotting (WB)

Specificité: C11 ORF46 antibody was raised against the N terminal Of C11 rf46

Purification: Affinity purified

Immunogène: C11 ORF46 antibody was raised using the N terminal Of C11 rf46 corresponding to a region with amino acids SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C11ORF46 Blocking Peptide, catalog no. 33R-8831, is also available for use as a blocking control in assays to test for specificity of this C11ORF46 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C11orf46

Antigène: C11orf46 (Chromosome 11 Open Reading Frame 46 (C11orf46))

Autre désignation: C11ORF46 (C11orf46 Produits)

Synonymes: anticorps MGC115732, anticorps ARF7EP, anticorps C11orf46, anticorps dJ299F11.1, anticorps 2700007P21Rik, anticorps 4930448O08Rik, anticorps RGD1311463, anticorps C15H11orf46, anticorps ARL14EP, anticorps ADP ribosylation factor like GTPase 14 effector protein L homeolog, anticorps ADP ribosylation factor like GTPase 14 effector protein, anticorps ADP-ribosylation factor-like 14 effector protein, anticorps ADP-ribosylation factor like GTPase 14 effector protein, anticorps arl14ep.L, anticorps arl14ep, anticorps ARL14EP, anticorps Arl14ep

Sujet: The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 29 kDa (MW of target protein)