EIF2AK1 anticorps (N-Term)

N° du produit ABIN631998

Détail du produit anti-EIF2AK1 anticorps

Antigène: EIF2AK1 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 1 (EIF2AK1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF2AK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF2 AK1 antibody was raised against the N terminal of EIF2 K1

Purification: Affinity purified

Immunogène: EIF2 AK1 antibody was raised using the N terminal of EIF2 K1 corresponding to a region with amino acids TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF2AK1 Blocking Peptide, catalog no. 33R-9000, is also available for use as a blocking control in assays to test for specificity of this EIF2AK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 K1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF2AK1

Antigène: EIF2AK1 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 1 (EIF2AK1))

Autre désignation: EIF2AK1 (EIF2AK1 Produits)

Synonymes: anticorps HCR, anticorps Hri, anticorps HRI, anticorps wu:fj97h09, anticorps zgc:153232, anticorps eukaryotic translation initiation factor 2 alpha kinase 1, anticorps eukaryotic translation initiation factor 2-alpha kinase 1, anticorps eukaryotic translation initiation factor 2 alpha kinase 1 L homeolog, anticorps EIF2AK1, anticorps eif2ak1, anticorps Eif2ak1, anticorps eif2ak1.L

Sujet: EIF2AK1 acts at the level of translation initiation to downregulate protein synthesis in response to stress. The protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 71 kDa (MW of target protein)

Pathways: Hepatitis C