PSG6 anticorps (N-Term)
-
- Antigène Voir toutes PSG6 Anticorps
- PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSG6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PSG6 antibody was raised against the N terminal of PSG6
- Purification
- Affinity purified
- Immunogène
- PSG6 antibody was raised using the N terminal of PSG6 corresponding to a region with amino acids VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV
- Top Product
- Discover our top product PSG6 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSG6 Blocking Peptide, catalog no. 33R-9675, is also available for use as a blocking control in assays to test for specificity of this PSG6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))
- Autre désignation
- PSG6 (PSG6 Produits)
- Synonymes
- anticorps PSBG-10, anticorps PSBG-12, anticorps PSBG-6, anticorps PSG10, anticorps PSGGB, anticorps PSG6, anticorps PSG3, anticorps pregnancy specific beta-1-glycoprotein 6, anticorps pregnancy-specific beta-1-glycoprotein 4, anticorps PSG6, anticorps LOC456082
- Sujet
- PSG6 may have a role in modulation of the innate immune system.
- Poids moléculaire
- 47 kDa (MW of target protein)
-