C21orf59 anticorps (N-Term)

N° du produit ABIN632002

Détail du produit anti-C21orf59 anticorps

Antigène: C21orf59 (Chromosome 21 Open Reading Frame 59 (C21orf59))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C21orf59 est non-conjugé

Application: Western Blotting (WB)

Specificité: C21 ORF59 antibody was raised against the N terminal Of C21 rf59

Purification: Affinity purified

Immunogène: C21 ORF59 antibody was raised using the N terminal Of C21 rf59 corresponding to a region with amino acids VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C21ORF59 Blocking Peptide, catalog no. 33R-9673, is also available for use as a blocking control in assays to test for specificity of this C21ORF59 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF59 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C21orf59

Antigène: C21orf59 (Chromosome 21 Open Reading Frame 59 (C21orf59))

Autre désignation: C21ORF59 (C21orf59 Produits)

Synonymes: anticorps C21orf59, anticorps MGC83493, anticorps C3H21orf59, anticorps C21orf48, anticorps RA_m005_jsm24C07r, anticorps chromosome 1 open reading frame, human C21orf59, anticorps chromosome 21 open reading frame 59 L homeolog, anticorps chromosome 3 C21orf59 homolog, anticorps chromosome 21 open reading frame 59, anticorps chromosome 3 open reading frame, human C21orf59, anticorps chromosome 14 open reading frame, human C21orf59, anticorps C1H21ORF59, anticorps c21orf59.L, anticorps C3H21orf59, anticorps c21orf59, anticorps C21orf59, anticorps C14H21orf59

Sujet: The function of the C21orf59 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 33 kDa (MW of target protein)