UCK2 anticorps (N-Term)
-
- Antigène Voir toutes UCK2 Anticorps
- UCK2 (Uridine-Cytidine Kinase 2 (UCK2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UCK2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UCK2 antibody was raised against the N terminal of UCK2
- Purification
- Affinity purified
- Immunogène
- UCK2 antibody was raised using the N terminal of UCK2 corresponding to a region with amino acids AGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDY
- Top Product
- Discover our top product UCK2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UCK2 Blocking Peptide, catalog no. 33R-1189, is also available for use as a blocking control in assays to test for specificity of this UCK2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UCK2 (Uridine-Cytidine Kinase 2 (UCK2))
- Autre désignation
- UCK2 (UCK2 Produits)
- Synonymes
- anticorps TSA903, anticorps UK, anticorps UMPK, anticorps AA407809, anticorps AI481316, anticorps AU018180, anticorps AU020720, anticorps UMK, anticorps Umpk, anticorps wu:fa20g04, anticorps zgc:56174, anticorps UCK2, anticorps DDBDRAFT_0202355, anticorps DDBDRAFT_0216233, anticorps DDB_0202355, anticorps DDB_0216233, anticorps DDBDRAFT_0167798, anticorps DDBDRAFT_0230208, anticorps DDB_0167798, anticorps DDB_0230208, anticorps UCK 2-A, anticorps umpk, anticorps wu:fk91a01, anticorps zgc:66240, anticorps uridine-cytidine kinase 2, anticorps uridine-cytidine kinase 2b, anticorps microRNA 3658, anticorps uridine-cytidine kinase 2 S homeolog, anticorps uridine kinase, anticorps Uridine kinase, anticorps toxin secretion ABC transporter ATP-binding protein, anticorps uridine-cytidine kinase 2a, anticorps UCK2, anticorps Uck2, anticorps uck2b, anticorps MIR3658, anticorps uck2.S, anticorps LOC692983, anticorps PTRG_08949, anticorps udkA, anticorps udkB, anticorps Mrub_2364, anticorps Mesil_2200, anticorps Spirs_2239, anticorps Tmar_0146, anticorps Bache_3005, anticorps Celal_2781, anticorps Deima_0461, anticorps Odosp_0439, anticorps Bacsa_1376, anticorps Celly_0243, anticorps Weevi_1813, anticorps Marky_0973, anticorps Spico_0967, anticorps Poras_0295, anticorps Theth_1915, anticorps uck2, anticorps XCC1480, anticorps uck2a
- Sujet
- UCK2 catalyzes the phosphorylation of uridine monophosphate to uridine diphosphate. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. In addition, an allele of this gene may play a role in mediating nonhumoral immunity to Hemophilus influenzae type B.
- Poids moléculaire
- 29 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Feeding Behaviour
-