UCK2 anticorps (N-Term)
-
- Antigène Voir toutes UCK2 Anticorps
- UCK2 (Uridine-Cytidine Kinase 2 (UCK2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UCK2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UCK2 antibody was raised against the N terminal of UCK2
- Purification
- Affinity purified
- Immunogène
- UCK2 antibody was raised using the N terminal of UCK2 corresponding to a region with amino acids AGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDY
- Top Product
- Discover our top product UCK2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UCK2 Blocking Peptide, catalog no. 33R-1189, is also available for use as a blocking control in assays to test for specificity of this UCK2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UCK2 (Uridine-Cytidine Kinase 2 (UCK2))
- Autre désignation
- UCK2 (UCK2 Produits)
- Sujet
- UCK2 catalyzes the phosphorylation of uridine monophosphate to uridine diphosphate. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. In addition, an allele of this gene may play a role in mediating nonhumoral immunity to Hemophilus influenzae type B.
- Poids moléculaire
- 29 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Feeding Behaviour
-