DESI1 anticorps (Middle Region)

N° du produit ABIN632008

Détail du produit anti-DESI1 anticorps

Antigène: DESI1 (PPPDE2) (PPPDE Peptidase Domain Containing 2 (PPPDE2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DESI1 est non-conjugé

Application: Western Blotting (WB)

Specificité: D15 WSU75 antibody was raised against the middle region of D15 su75

Purification: Affinity purified

Immunogène: D15 WSU75 antibody was raised using the middle region of D15 su75 corresponding to a region with amino acids FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

D15WSU75E Blocking Peptide, catalog no. 33R-2991, is also available for use as a blocking control in assays to test for specificity of this D15WSU75E antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of D10 SU70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DESI1

Antigène: DESI1 (PPPDE2) (PPPDE Peptidase Domain Containing 2 (PPPDE2))

Autre désignation: D15WSU75E (PPPDE2 Produits)

Synonymes: anticorps D15Wsu75e, anticorps DESI2, anticorps DJ347H13.4, anticorps DeSI-1, anticorps FAM152B, anticorps PPPDE2, anticorps AI427858, anticorps AI850401, anticorps Fam152b, anticorps Pppde2, anticorps RGD1305776, anticorps fam152b, anticorps pppde2, anticorps desumoylating isopeptidase 1, anticorps desumoylating isopeptidase 1 L homeolog, anticorps DESI1, anticorps Desi1, anticorps desi1.L

Sujet: The function of D15WSU75E protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 18 kDa (MW of target protein)