TPD52L3 anticorps (Middle Region)
-
- Antigène Voir toutes TPD52L3 Anticorps
- TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TPD52L3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TPD52 L3 antibody was raised against the middle region of TPD52 3
- Purification
- Affinity purified
- Immunogène
- TPD52 L3 antibody was raised using the middle region of TPD52 3 corresponding to a region with amino acids GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS
- Top Product
- Discover our top product TPD52L3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TPD52L3 Blocking Peptide, catalog no. 33R-3418, is also available for use as a blocking control in assays to test for specificity of this TPD52L3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPD50 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))
- Autre désignation
- TPD52L3 (TPD52L3 Produits)
- Synonymes
- anticorps NYDSP25, anticorps hD55, anticorps 4931412G03Rik, anticorps Trpd52l3, anticorps RGD1309391, anticorps TPD52L3, anticorps TRPD52L3, anticorps tumor protein D52 like 3, anticorps tumor protein D52-like 3, anticorps TPD52L3, anticorps Trpd52l3, anticorps Tpd52l3
- Sujet
- TPD52L3 encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.
- Poids moléculaire
- 15 kDa (MW of target protein)
-