RIPK4 anticorps (N-Term)

N° du produit ABIN632015

Détail du produit anti-RIPK4 anticorps

Antigène: RIPK4 (Receptor-Interacting Serine-threonine Kinase 4 (RIPK4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RIPK4 est non-conjugé

Application: Western Blotting (WB)

Specificité: RIPK4 antibody was raised against the N terminal of RIPK4

Purification: Affinity purified

Immunogène: RIPK4 antibody was raised using the N terminal of RIPK4 corresponding to a region with amino acids DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RIPK4 Blocking Peptide, catalog no. 33R-1956, is also available for use as a blocking control in assays to test for specificity of this RIPK4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIPK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RIPK4

Antigène: RIPK4 (Receptor-Interacting Serine-threonine Kinase 4 (RIPK4))

Autre désignation: RIPK4 (RIPK4 Produits)

Synonymes: anticorps dik, anticorps pkk, anticorps rip4, anticorps ankk2, anticorps ankrd3, anticorps ripk4a, anticorps MGC53701, anticorps MGC132134, anticorps zgc:55705, anticorps wu:fj80b10, anticorps ripk4b, anticorps RIPK4, anticorps ANKK2, anticorps ANKRD3, anticorps DIK, anticorps NKRD3, anticorps PKK, anticorps PPS2, anticorps RIP4, anticorps 2310069J12Rik, anticorps AI552420, anticorps Ankrd3, anticorps DIk, anticorps receptor interacting serine/threonine kinase 4 L homeolog, anticorps receptor-interacting serine-threonine kinase 4, anticorps receptor interacting serine/threonine kinase 4, anticorps receptor interacting serine/threonine kinase 4 S homeolog, anticorps ripk4.L, anticorps ripk4, anticorps RIPK4, anticorps ripk4.S, anticorps Ripk4

Sujet: RIPK4 is a serine/threonine protein kinase that interacts with protein kinase C-delta. The protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation.

Poids moléculaire: 86 kDa (MW of target protein)