ALAD anticorps (N-Term)

N° du produit ABIN632017

Détail du produit anti-ALAD anticorps

Antigène: ALAD (Aminolevulinate Dehydratase (ALAD))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALAD est non-conjugé

Application: Western Blotting (WB)

Specificité: ALAD antibody was raised against the N terminal of ALAD

Purification: Affinity purified

Immunogène: ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALAD Blocking Peptide, catalog no. 33R-7682, is also available for use as a blocking control in assays to test for specificity of this ALAD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALAD

Antigène: ALAD (Aminolevulinate Dehydratase (ALAD))

Autre désignation: ALAD (ALAD Produits)

Synonymes: anticorps DDBDRAFT_0190269, anticorps DDBDRAFT_0231415, anticorps DDB_0190269, anticorps DDB_0231415, anticorps ALAD, anticorps ncf, anticorps ALADH, anticorps PBGS, anticorps ALADR, anticorps aminolevulinatedelta-dehydratase, anticorps zgc:110219, anticorps Lv, anticorps delta-aminolevulinate dehydratase, anticorps aminolevulinate dehydratase, anticorps delta-aminolevulinic acid dehydratase, anticorps Delta-aminolevulinic acid dehydratase, anticorps aminolevulinate dehydratase L homeolog, anticorps aminolevulinate, delta-, dehydratase, anticorps hemB, anticorps ALAD, anticorps PBGS, anticorps STY0404, anticorps SAS1597, anticorps SACI_RS03725, anticorps PAAG_00299, anticorps VDBG_00315, anticorps HPPC_00830, anticorps MGYG_01952, anticorps hem2, anticorps alad.L, anticorps Alad, anticorps alad

Sujet: The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway, zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.

Poids moléculaire: 37 kDa (MW of target protein)