AKAP10 anticorps

N° du produit ABIN632020

Détail du produit anti-AKAP10 anticorps

Antigène: AKAP10 (A Kinase (PRKA) Anchor Protein 10 (AKAP10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKAP10 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: AKAP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AKAP10 Blocking Peptide, catalog no. 33R-2735, is also available for use as a blocking control in assays to test for specificity of this AKAP10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AKAP10

Antigène: AKAP10 (A Kinase (PRKA) Anchor Protein 10 (AKAP10))

Autre désignation: AKAP10 (AKAP10 Produits)

Synonymes: anticorps MGC84612, anticorps AKAP10, anticorps fc10g11, anticorps wu:fc10g11, anticorps si:dkey-197m14.4, anticorps AKAP-10, anticorps D-AKAP-2, anticorps D-AKAP2, anticorps PRKA10, anticorps 1500031L16Rik, anticorps B130049N18Rik, anticorps D-akap2, anticorps Akap10, anticorps A-kinase anchoring protein 10, anticorps A-kinase anchoring protein 10 L homeolog, anticorps A kinase (PRKA) anchor protein 10, anticorps AKAP10, anticorps akap10.L, anticorps akap10, anticorps Akap10

Sujet: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA, therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.

Poids moléculaire: 71 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling