RAB40C anticorps (N-Term)

N° du produit ABIN632024

Détail du produit anti-RAB40C anticorps

Antigène: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB40C est non-conjugé

Application: Western Blotting (WB)

Specificité: RAB40 C antibody was raised against the N terminal of RAB40

Purification: Affinity purified

Immunogène: RAB40 C antibody was raised using the N terminal of RAB40 corresponding to a region with amino acids QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB40C Blocking Peptide, catalog no. 33R-7497, is also available for use as a blocking control in assays to test for specificity of this RAB40C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB40C

Antigène: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Autre désignation: RAB40C (RAB40C Produits)

Sujet: RAB40C is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Poids moléculaire: 31 kDa (MW of target protein)