NOXRED1 anticorps (Middle Region)

N° du produit ABIN632026

Détail du produit anti-NOXRED1 anticorps

Antigène: NOXRED1 (C14orf148) (Chromosome 14 Open Reading Frame 148 (C14orf148))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOXRED1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C14 ORF148 antibody was raised against the middle region of C14 rf148

Purification: Affinity purified

Immunogène: C14 ORF148 antibody was raised using the middle region of C14 rf148 corresponding to a region with amino acids KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF148 Blocking Peptide, catalog no. 33R-4517, is also available for use as a blocking control in assays to test for specificity of this C14ORF148 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF148 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOXRED1

Antigène: NOXRED1 (C14orf148) (Chromosome 14 Open Reading Frame 148 (C14orf148))

Autre désignation: C14ORF148 (C14orf148 Produits)

Synonymes: anticorps C14orf148, anticorps 4933437F05Rik, anticorps NADP dependent oxidoreductase domain containing 1, anticorps NADP+ dependent oxidoreductase domain containing 1, anticorps NOXRED1, anticorps Noxred1

Sujet: C14Orf148 probably functions an an oxidoreductase.

Poids moléculaire: 39 kDa (MW of target protein)