NOXRED1 anticorps (Middle Region)
-
- Antigène Voir toutes NOXRED1 (C14orf148) Anticorps
- NOXRED1 (C14orf148) (Chromosome 14 Open Reading Frame 148 (C14orf148))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NOXRED1 est non-conjugé
- Application
- Western Blotting (WB)
- Specificité
- C14 ORF148 antibody was raised against the middle region of C14 rf148
- Purification
- Affinity purified
- Immunogène
- C14 ORF148 antibody was raised using the middle region of C14 rf148 corresponding to a region with amino acids KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG
- Top Product
- Discover our top product C14orf148 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C14ORF148 Blocking Peptide, catalog no. 33R-4517, is also available for use as a blocking control in assays to test for specificity of this C14ORF148 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF148 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NOXRED1 (C14orf148) (Chromosome 14 Open Reading Frame 148 (C14orf148))
- Autre désignation
- C14ORF148 (C14orf148 Produits)
- Synonymes
- anticorps C14orf148, anticorps 4933437F05Rik, anticorps NADP dependent oxidoreductase domain containing 1, anticorps NADP+ dependent oxidoreductase domain containing 1, anticorps NOXRED1, anticorps Noxred1
- Sujet
- C14Orf148 probably functions an an oxidoreductase.
- Poids moléculaire
- 39 kDa (MW of target protein)
-