MAT2B anticorps (Middle Region)
-
- Antigène Voir toutes MAT2B Anticorps
- MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAT2B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAT2 B antibody was raised against the middle region of MAT2
- Purification
- Affinity purified
- Immunogène
- MAT2 B antibody was raised using the middle region of MAT2 corresponding to a region with amino acids GNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGE
- Top Product
- Discover our top product MAT2B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAT2B Blocking Peptide, catalog no. 33R-3451, is also available for use as a blocking control in assays to test for specificity of this MAT2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))
- Autre désignation
- MAT2B (MAT2B Produits)
- Synonymes
- anticorps MAT-II, anticorps MATIIbeta, anticorps Nbla02999, anticorps SDR23E1, anticorps TGR, anticorps 1110064C04Rik, anticorps 2410018D16Rik, anticorps AI182287, anticorps AU022853, anticorps fc55d01, anticorps wu:fb48h02, anticorps wu:fc55d01, anticorps zgc:110308, anticorps MAT2beta, anticorps methionine adenosyltransferase 2B, anticorps methionine adenosyltransferase II, beta, anticorps methionine adenosyltransferase II, beta L homeolog, anticorps MAT2B, anticorps Mat2b, anticorps mat2b, anticorps mat2b.L
- Sujet
- MAT2B belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process, SARS-CoV-2 Protein Interactome
-