C11orf54 anticorps (N-Term)

N° du produit ABIN632029

Détail du produit anti-C11orf54 anticorps

Antigène: C11orf54 (Chromosome 11 Open Reading Frame 54 (C11orf54))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C11orf54 est non-conjugé

Application: Western Blotting (WB)

Specificité: C11 ORF54 antibody was raised against the N terminal Of C11 rf54

Purification: Affinity purified

Immunogène: C11 ORF54 antibody was raised using the N terminal Of C11 rf54 corresponding to a region with amino acids CPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C11ORF54 Blocking Peptide, catalog no. 33R-1759, is also available for use as a blocking control in assays to test for specificity of this C11ORF54 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C11orf54

Antigène: C11orf54 (Chromosome 11 Open Reading Frame 54 (C11orf54))

Autre désignation: C11ORF54 (C11orf54 Produits)

Synonymes: anticorps PTD012, anticorps C11orf54, anticorps fb58g01, anticorps wu:fb58g01, anticorps wu:fc54a08, anticorps chromosome 11 open reading frame 54, anticorps chromosome 29 open reading frame, human C11orf54, anticorps chromosome 1 open reading frame, human C11orf54, anticorps chromosome 11 open reading frame 54 L homeolog, anticorps RIKEN cDNA 4931406C07 gene, anticorps zgc:85789, anticorps C11orf54, anticorps C29H11orf54, anticorps C1H11ORF54, anticorps c11orf54.L, anticorps c11orf54, anticorps 4931406C07Rik, anticorps zgc:85789

Sujet: C11orf54 exhibits ester hydrolase activity on the substrate p-nitrophenyl acetate.

Poids moléculaire: 29 kDa (MW of target protein)